EC El Corazón Cantina
Weekly meals

Weeknight Meal Prep

Chef-made bowls and taco kits, cooked fresh every Tuesday. Pick your meals by Sunday night, grab them Tuesday after 4 — or subscribe and never think about dinner again.

Order Meals for the Week

Week of September 21, 2026

Ordering is open — order by Sunday, Sep 20, 8:00 PM.

Pollo Asado Bowl$12.99

Citrus-achiote grilled chicken over jasmine rice and black beans with pico, cotija and lime.

high-proteingluten-freedairy

640 cal · 46g protein

Carne Asada Taco Kit$13.99

Marinated skirt steak, three tortillas, onion-cilantro and salsa roja — assemble at home in two minutes.

high-proteingluten-freedairy-free

590 cal · 38g protein

Baja Salmon Bowl$14.99

Seared salmon, jasmine rice, charred broccoli, avocado and lime crema.

high-proteingluten-freefishdairy

610 cal · 41g protein

Chile Verde Bowl$12.99

Three-hour braised pork in tomatillo-poblano salsa over rice and beans.

high-proteingluten-freedairy

680 cal · 42g protein

Hongos Veggie Bowl$11.49

Chile-roasted mushrooms and broccoli, black beans, rice, avocado and salsa verde. Vegan.

veganvegetariangluten-freedairy-free

520 cal · 18g protein

Kids' Quesadilla Plate$7.99

Cheese quesadilla, cilantro-lime rice and a fruit cup. Mild, kid-approved.

kid-friendlyvegetariandairywheatgluten

430 cal · 16g protein

How it works

1 · Pick your mealsChoose 4–30 meals from the weekly menu or grab a plan.
2 · Order by the cutoffEach week closes at a set time so we can cook exactly what's ordered.
3 · Cooked freshPrepared in our kitchen and packed with reheating instructions.
4 · Pick up or get it deliveredPickup 4–6 PM / 6–8 PM. Delivery ($5.99) 5–8 PM.

Meal plans & subscriptions

5-Meal Pack
$59.99
5 meals · $12.00 each
Five meals, mix and match. Our most popular for one person.
Available as a weekly subscription — skip or pause any time before the cutoff.
10-Meal Pack
$114.99
10 meals · $11.50 each
Ten meals for the week — lunch and dinner sorted.
Available as a weekly subscription — skip or pause any time before the cutoff.
Build your own
You choose
Pick 4–30 meals, priced per meal
Pick any 4 or more meals at menu price.
Available as a weekly subscription — skip or pause any time before the cutoff.
Family Fiesta Box
$99.99
8 meals · $12.50 each
Feeds four: Pollo Asado Bowls, Carne Asada Taco Kits and two Kids' plates.

Good to know

When do I need to order by?
Orders for the week of September 21, 2026 close Sunday, Sep 20, 8:00 PM. Every week has its own cutoff shown on the menu.
How do I reheat the meals?
Each meal comes with its own reheating instructions (also listed on the menu and in your account).
Do you list allergens?
Yes — every meal shows its allergens, dietary tags and nutrition.
Can I skip a week or cancel?
Yes. From your account you can change meals, skip a week, pause or cancel before the cutoff. After the cutoff: Skips and changes close with ordering on Sunday at 8 PM. After that the week is charged and produced.
Are there any fees?
A small convivo meals service fee is shown at checkout, plus $5.99 for delivery.
Order Meals for the Week